XRN1 antibody (Middle Region)
-
- Target See all XRN1 Antibodies
- XRN1 (5'-3' Exoribonuclease 1 (XRN1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This XRN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- XRN1 antibody was raised against the middle region of XRN1
- Purification
- Affinity purified
- Immunogen
- XRN1 antibody was raised using the middle region of XRN1 corresponding to a region with amino acids LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM
- Top Product
- Discover our top product XRN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
XRN1 Blocking Peptide, catalog no. 33R-5282, is also available for use as a blocking control in assays to test for specificity of this XRN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- XRN1 (5'-3' Exoribonuclease 1 (XRN1))
- Alternative Name
- XRN1 (XRN1 Products)
- Synonyms
- wu:fk92c07 antibody, zgc:63635 antibody, SEP1 antibody, Dhm2 antibody, exo antibody, mXrn1 antibody, RGD1309713 antibody, 5'-3' exoribonuclease 1 antibody, xrn1 antibody, XRN1 antibody, Tsp_05930 antibody, Xrn1 antibody
- Background
- SEP1 (XRN1) localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly.
- Molecular Weight
- 194 kDa (MW of target protein)
-