EXOSC7 antibody (N-Term)

Catalog No. ABIN633320

The Rabbit Polyclonal anti-EXOSC7 antibody has been validated for WB. It is suitable to detect EXOSC7 in samples from Human and Mouse.

Quick Overview for EXOSC7 antibody (N-Term) (ABIN633320)

Target: EXOSC7 (Exosome Component 7 (EXOSC7))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOSC7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EXOSC7 Antibody

Binding Specificity: N-Term

Specificity: EXOSC7 antibody was raised against the N terminal of EXOSC7

Purification: Affinity purified

Immunogen: EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOSC7 Blocking Peptide, (ABIN938166), is also available for use as a blocking control in assays to test for specificity of this EXOSC7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOSC7

Target: EXOSC7 (Exosome Component 7 (EXOSC7))

Alternative Name: EXOSC7

Background: EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. The protein is required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA.

Molecular Weight: 32 kDa (MW of target protein)