EXOSC7 antibody (N-Term)
-
- Target See all EXOSC7 Antibodies
- EXOSC7 (Exosome Component 7 (EXOSC7))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EXOSC7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EXOSC7 antibody was raised against the N terminal of EXOSC7
- Purification
- Affinity purified
- Immunogen
- EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC
- Top Product
- Discover our top product EXOSC7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EXOSC7 Blocking Peptide, catalog no. 33R-2780, is also available for use as a blocking control in assays to test for specificity of this EXOSC7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EXOSC7 (Exosome Component 7 (EXOSC7))
- Alternative Name
- EXOSC7 (EXOSC7 Products)
- Synonyms
- EXOSC7 antibody, zgc:110717 antibody, EAP1 antibody, RRP42 antibody, Rrp42p antibody, hRrp42p antibody, p8 antibody, 2610002K22Rik antibody, AV212732 antibody, mKIAA0116 antibody, exosome component 7 antibody, exosome component 7 S homeolog antibody, exosc7 antibody, EXOSC7 antibody, exosc7.S antibody, Exosc7 antibody
- Background
- EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. The protein is required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA.
- Molecular Weight
- 32 kDa (MW of target protein)
-