BOLL antibody

Catalog No. ABIN633322

Product Details anti-BOLL Antibody

Target: BOLL (Bol, Boule-Like (BOLL))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BOLL antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: BOLL antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BOLL Blocking Peptide, catalog no. 33R-3288, is also available for use as a blocking control in assays to test for specificity of this BOLL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BOLL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BOLL

Target: BOLL (Bol, Boule-Like (BOLL))

Alternative Name: BOLL (BOLL Products)

Synonyms: BOULE antibody, 4930554P13Rik antibody, 4930597B14Rik antibody, RGD1559527 antibody, boule homolog, RNA binding protein antibody, bol, boule-like (Drosophila) antibody, BOLL antibody, Boll antibody

Background: This gene belongs to the DAZ gene family required for germ cell development. BOLL is an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition.

Molecular Weight: 31 kDa (MW of target protein)