THOC1 antibody (C-Term)

Catalog No. ABIN633337

This Rabbit Polyclonal antibody specifically detects THOC1 in WB and IHC. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for THOC1 antibody (C-Term) (ABIN633337)

Target: THOC1 (THO Complex 1 (THOC1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This THOC1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-THOC1 Antibody

Binding Specificity: C-Term

Specificity: THOC1 antibody was raised against the C terminal of THOC1

Purification: Affinity purified

Immunogen: THOC1 antibody was raised using the C terminal of THOC1 corresponding to a region with amino acids TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

THOC1 Blocking Peptide, (ABIN5616588), is also available for use as a blocking control in assays to test for specificity of this THOC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for THOC1

Target: THOC1 (THO Complex 1 (THOC1))

Alternative Name: THOC1

Background: THOC1 is part of the TREX (transcription/export) complex, which includes TEX1, THO2, ALY, and UAP56.

Molecular Weight: 76 kDa (MW of target protein)