EIF3B antibody (C-Term)

Catalog No. ABIN633340

This Rabbit Polyclonal antibody specifically detects EIF3B in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for EIF3B antibody (C-Term) (ABIN633340)

Target: EIF3B (Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF3B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EIF3B Antibody

Binding Specificity: C-Term

Specificity: EIF3 S9 antibody was raised against the C terminal of EIF3 9

Purification: Affinity purified

Immunogen: EIF3 S9 antibody was raised using the C terminal of EIF3 9 corresponding to a region with amino acids YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF3S9 Blocking Peptide, (ABIN936200), is also available for use as a blocking control in assays to test for specificity of this EIF3S9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF3B

Target: EIF3B (Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B))

Alternative Name: EIF3S9

Background: EIF3S9 binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA.

Molecular Weight: 90 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization