HNRNPA1L2 antibody (N-Term)

Catalog No. ABIN633345

This anti-HNRNPA1L2 antibody is a Rabbit Polyclonal antibody detecting HNRNPA1L2 in WB and IHC. Suitable for Human, Dog, Mouse and Rat.

Quick Overview for HNRNPA1L2 antibody (N-Term) (ABIN633345)

Target: HNRNPA1L2 (Heterogeneous Nuclear Ribonucleoprotein A1-Like 2 (HNRNPA1L2))

Reactivity: Human, Dog, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HNRNPA1L2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-HNRNPA1L2 Antibody

Binding Specificity: N-Term

Specificity: RP11-78 J21.1 antibody was raised against the N terminal of RP11-78 21.1

Purification: Affinity purified

Immunogen: RP11-78 J21.1 antibody was raised using the N terminal of RP11-78 21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RP.1 Blocking Peptide, (ABIN5615924), is also available for use as a blocking control in assays to test for specificity of this RP.1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-70 21.1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HNRNPA1L2

Target: HNRNPA1L2 (Heterogeneous Nuclear Ribonucleoprotein A1-Like 2 (HNRNPA1L2))

Background: The function of RP11-78J21.1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 35 kDa (MW of target protein)