GRSF1 antibody (Middle Region)

Catalog No. ABIN633346

This Rabbit Polyclonal antibody specifically detects GRSF1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for GRSF1 antibody (Middle Region) (ABIN633346)

Target: GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRSF1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GRSF1 Antibody

Binding Specificity: Middle Region

Specificity: GRSF1 antibody was raised against the middle region of GRSF1

Purification: Affinity purified

Immunogen: GRSF1 antibody was raised using the middle region of GRSF1 corresponding to a region with amino acids IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GRSF1 Blocking Peptide, (ABIN939525), is also available for use as a blocking control in assays to test for specificity of this GRSF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRSF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GRSF1

Target: GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))

Alternative Name: GRSF1

Background: GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.

Molecular Weight: 53 kDa (MW of target protein)