CELF4 antibody

Catalog No. ABIN633349

This Rabbit Polyclonal antibody specifically detects CELF4 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for CELF4 antibody (ABIN633349)

Target: CELF4 (CUGBP, Elav-Like Family Member 4 (CELF4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CELF4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CELF4 Antibody

Purification: Affinity purified

Immunogen: BRUNOL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BRUNOL4 Blocking Peptide, (ABIN5612366), is also available for use as a blocking control in assays to test for specificity of this BRUNOL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CELF4

Target: CELF4 (CUGBP, Elav-Like Family Member 4 (CELF4))

Alternative Name: BRUNOL4

Background: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Synaptic Membrane