RBM22 antibody (Middle Region)

Catalog No. ABIN633354

This anti-RBM22 antibody is a Rabbit Polyclonal antibody detecting RBM22 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for RBM22 antibody (Middle Region) (ABIN633354)

Target: RBM22 (RNA Binding Motif Protein 22 (RBM22))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM22 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RBM22 Antibody

Binding Specificity: Middle Region

Specificity: RBM22 antibody was raised against the middle region of RBM22

Purification: Affinity purified

Immunogen: RBM22 antibody was raised using the middle region of RBM22 corresponding to a region with amino acids HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM22 Blocking Peptide, (ABIN939118), is also available for use as a blocking control in assays to test for specificity of this RBM22 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM22

Target: RBM22 (RNA Binding Motif Protein 22 (RBM22))

Alternative Name: RBM22

Background: RBM22 may be involved in pre-mRNA splicing.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus