DDX25 antibody

Catalog No. ABIN633365

The Rabbit Polyclonal anti-DDX25 antibody has been validated for WB. It is suitable to detect DDX25 in samples from Human, Mouse, Rat and Dog.

Quick Overview for DDX25 antibody (ABIN633365)

Target: DDX25 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 25 (DDX25))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX25 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DDX25 Antibody

Purification: Affinity purified

Immunogen: DDX25 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX25 Blocking Peptide, (ABIN5613158), is also available for use as a blocking control in assays to test for specificity of this DDX25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX25

Target: DDX25 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 25 (DDX25))

Alternative Name: DDX25

Background: DDX25 is a member of DEAD box proteins family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Molecular Weight: 41 kDa (MW of target protein)