DHX35 antibody

Catalog No. ABIN633370

Product Details anti-DHX35 Antibody

Target: DHX35 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 35 (DHX35))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHX35 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DHX35 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHX35 Blocking Peptide, catalog no. 33R-5605, is also available for use as a blocking control in assays to test for specificity of this DHX35 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DHX35

Target: DHX35 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 35 (DHX35))

Alternative Name: DHX35 (DHX35 Products)

Synonyms: MGC146350 antibody, C20orf15 antibody, DDX35 antibody, KAIA0875 antibody, 1200009D07Rik antibody, Ddx35 antibody, probable ATP-dependent RNA helicase DHX35 antibody, DEAH-box helicase 35 antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 35 antibody, LOC413147 antibody, DHX35 antibody, dhx35 antibody, LOC100633419 antibody, Dhx35 antibody

Background: DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of DHX35 which is a member of this family, has not been determined.

Molecular Weight: 79 kDa (MW of target protein)