RBMY1A1 antibody (N-Term)

Catalog No. ABIN633380

The Rabbit Polyclonal anti-RBMY1A1 antibody has been validated for WB. It is suitable to detect RBMY1A1 in samples from Human.

Quick Overview for RBMY1A1 antibody (N-Term) (ABIN633380)

Target: RBMY1A1 (RNA Binding Motif Protein, Y-Linked Family 1 Member A1 (RBMY1A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBMY1A1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RBMY1A1 Antibody

Binding Specificity: N-Term

Specificity: RBMY1 A1 antibody was raised against the N terminal of RBMY1 1

Purification: Affinity purified

Immunogen: RBMY1 A1 antibody was raised using the N terminal of RBMY1 1 corresponding to a region with amino acids MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBMY1A1 Blocking Peptide, (ABIN5615807), is also available for use as a blocking control in assays to test for specificity of this RBMY1A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMY0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBMY1A1

Target: RBMY1A1 (RNA Binding Motif Protein, Y-Linked Family 1 Member A1 (RBMY1A1))

Alternative Name: RBMY1A1

Background: RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.

Molecular Weight: 41 kDa (MW of target protein)