MGC70863 antibody (N-Term)

Catalog No. ABIN633386

The Rabbit Polyclonal anti-MGC70863 antibody has been validated for WB. It is suitable to detect MGC70863 in samples from Human.

Quick Overview for MGC70863 antibody (N-Term) (ABIN633386)

Target: MGC70863 (RPL23AP82) (Ribosomal Protein L23a Pseudogene 82 (RPL23AP82))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Application: Western Blotting (WB)

Product Details anti-MGC70863 Antibody

Binding Specificity: N-Term

Specificity: MGC70863 antibody was raised against the N terminal of MGC70863

Purification: Affinity purified

Immunogen: MGC70863 antibody was raised using the N terminal of MGC70863 corresponding to a region with amino acids MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC70863 Blocking Peptide, (ABIN5614755), is also available for use as a blocking control in assays to test for specificity of this MGC70863 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC70863 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MGC70863

Target: MGC70863 (RPL23AP82) (Ribosomal Protein L23a Pseudogene 82 (RPL23AP82))

Alternative Name: MGC70863

Background: The function of MGC70863 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 14 kDa (MW of target protein)