MGC70863 antibody (N-Term)
-
- Target
- MGC70863 (RPL23AP82) (Ribosomal Protein L23a Pseudogene 82 (RPL23AP82))
- Binding Specificity
- N-Term
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Western Blotting (WB)
- Specificity
- MGC70863 antibody was raised against the N terminal of MGC70863
- Purification
- Affinity purified
- Immunogen
- MGC70863 antibody was raised using the N terminal of MGC70863 corresponding to a region with amino acids MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIE
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MGC70863 Blocking Peptide, catalog no. 33R-6469, is also available for use as a blocking control in assays to test for specificity of this MGC70863 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC70863 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MGC70863 (RPL23AP82) (Ribosomal Protein L23a Pseudogene 82 (RPL23AP82))
- Alternative Name
- MGC70863
- Synonyms
- MGC70863 antibody, RPL23A_43_1761 antibody, ribosomal protein L23a pseudogene 82 antibody, RPL23AP82 antibody
- Background
- The function of MGC70863 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 14 kDa (MW of target protein)
-