RBM4 antibody (Middle Region)

Catalog No. ABIN633396

Product Details anti-RBM4 Antibody

Target: RBM4 (RNA Binding Motif Protein 4 (RBM4))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBM4 antibody was raised against the middle region of RBM4

Purification: Affinity purified

Immunogen: RBM4 antibody was raised using the middle region of RBM4 corresponding to a region with amino acids TAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPY

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM4 Blocking Peptide, catalog no. 33R-8981, is also available for use as a blocking control in assays to test for specificity of this RBM4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM4

Target: RBM4 (RNA Binding Motif Protein 4 (RBM4))

Alternative Name: RBM4 (RBM4 Products)

Background: RBM4 contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing. RBM4 is down-regulated in fetal Down syndrome (DS) brain.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Photoperiodism