OLA1 antibody

Catalog No. ABIN633398

The Rabbit Polyclonal anti-OLA1 antibody has been validated for WB. It is suitable to detect OLA1 in samples from Human, Mouse, Rat, Zebrafish (Danio rerio) and Drosophila melanogaster.

Quick Overview for OLA1 antibody (ABIN633398)

Target: OLA1 (Obg-Like ATPase 1 (OLA1))

Reactivity: Human, Mouse, Rat, Zebrafish (Danio rerio), Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OLA1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-OLA1 Antibody

Purification: Affinity purified

Immunogen: GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVE

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GTPBP9 Blocking Peptide, (ABIN5613906), is also available for use as a blocking control in assays to test for specificity of this GTPBP9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OLA1

Target: OLA1 (Obg-Like ATPase 1 (OLA1))

Alternative Name: GTPBP9

Background: GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.

Molecular Weight: 44 kDa (MW of target protein)