RPS7 antibody (N-Term)

Catalog No. ABIN633403

This Rabbit Polyclonal antibody specifically detects RPS7 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for RPS7 antibody (N-Term) (ABIN633403)

Target: RPS7 (Ribosomal Protein S7 (RPS7))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPS7 Antibody

Binding Specificity: N-Term

Specificity: RPS7 antibody was raised against the N terminal of RPS7

Purification: Affinity purified

Immunogen: RPS7 antibody was raised using the N terminal of RPS7 corresponding to a region with amino acids MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS7 Blocking Peptide, (ABIN5615953), is also available for use as a blocking control in assays to test for specificity of this RPS7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS7

Target: RPS7 (Ribosomal Protein S7 (RPS7))

Alternative Name: RPS7

Background: RPS7 is required for rRNA maturation.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Molecular Weight: 22 kDa (MW of target protein)

Pathways: Tube Formation