EIF2D antibody (Middle Region)

Catalog No. ABIN633404

The Rabbit Polyclonal anti-EIF2D antibody is suitable to detect EIF2D in samples from Human. It has been validated for WB.

Quick Overview for EIF2D antibody (Middle Region) (ABIN633404)

Target: EIF2D (Eukaryotic Translation Initiation Factor 2D (EIF2D))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF2D antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EIF2D Antibody

Binding Specificity: Middle Region

Specificity: Ligatin antibody was raised against the middle region of LGTN

Purification: Affinity purified

Immunogen: Ligatin antibody was raised using the middle region of LGTN corresponding to a region with amino acids KVTVVRNLEAYGLDPYSVAAILQQRCQASTTVNPAPGAKDSLQVQIQGNQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Ligatin Blocking Peptide, (ABIN940111), is also available for use as a blocking control in assays to test for specificity of this Ligatin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF2D

Target: EIF2D (Eukaryotic Translation Initiation Factor 2D (EIF2D))

Alternative Name: Ligatin

Background: LGTN is a protein receptor that localizes phosphoglycoproteins within endosomes and at the cell periphery. This trafficking receptor for phosphoglycoproteins may play a role in neuroplasticity by modulating cell-cell interactions, intracellular adhesion, and protein binding at membrane surfaces. In hippocampal neurons, long-lasting down-regulation of ligatin mRNA levels occurs via post-transcriptional RNA processing following glutamate receptor activation. This protein contains single PUA and SUI1 domains and these domains may function in RNA binding and translation initiation, respectively.

Molecular Weight: 65 kDa (MW of target protein)