ELAVL4 antibody (N-Term)

Catalog No. ABIN633409

This Rabbit Polyclonal antibody specifically detects ELAVL4 in WB. It exhibits reactivity toward Human.

Quick Overview for ELAVL4 antibody (N-Term) (ABIN633409)

Target: ELAVL4 (ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 4 (Hu Antigen D) (ELAVL4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ELAVL4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ELAVL4 Antibody

Binding Specificity: N-Term

Specificity: ELAVL4 antibody was raised against the N terminal of ELAVL4

Purification: Affinity purified

Immunogen: ELAVL4 antibody was raised using the N terminal of ELAVL4 corresponding to a region with amino acids MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ELAVL4 Blocking Peptide, (ABIN5613357), is also available for use as a blocking control in assays to test for specificity of this ELAVL4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELAVL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ELAVL4

Target: ELAVL4 (ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 4 (Hu Antigen D) (ELAVL4))

Alternative Name: ELAVL4

Background: ELAVL4 may play a role in neuron-specific RNA processing. ELAVL4 protects CDKN1A mRNA from decay by binding to its 3'-UTR By similarity. ELAVL4 binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.

Molecular Weight: 42 kDa (MW of target protein)