PABPC5 antibody

Catalog No. ABIN633413

The Rabbit Polyclonal anti-PABPC5 antibody has been validated for WB. It is suitable to detect PABPC5 in samples from Human and Mouse.

Quick Overview for PABPC5 antibody (ABIN633413)

Target: PABPC5 (Poly(A) Binding Protein, Cytoplasmic 5 (PABPC5))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PABPC5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PABPC5 Antibody

Purification: Affinity purified

Immunogen: PABPC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PABPC5 Blocking Peptide, (ABIN937235), is also available for use as a blocking control in assays to test for specificity of this PABPC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PABPC5

Target: PABPC5 (Poly(A) Binding Protein, Cytoplasmic 5 (PABPC5))

Alternative Name: PABPC5

Background: PABPC5 binds the poly(A) tail of mRNA. PABPC5 may be involved in cytoplasmic regulatory processes of mRNA metabolism. PABPC5 can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo.

Molecular Weight: 43 kDa (MW of target protein)