GIPC1 antibody (N-Term)
-
- Target See all GIPC1 Antibodies
- GIPC1 (GIPC PDZ Domain Containing Family, Member 1 (GIPC1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Zebrafish (Danio rerio), Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GIPC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GIPC1 antibody was raised against the N terminal of GIPC1
- Purification
- Affinity purified
- Immunogen
- GIPC1 antibody was raised using the N terminal of GIPC1 corresponding to a region with amino acids SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA
- Top Product
- Discover our top product GIPC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GIPC1 Blocking Peptide, catalog no. 33R-8461, is also available for use as a blocking control in assays to test for specificity of this GIPC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIPC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GIPC1 (GIPC PDZ Domain Containing Family, Member 1 (GIPC1))
- Alternative Name
- GIPC1 (GIPC1 Products)
- Synonyms
- C19orf3 antibody, GIPC antibody, GLUT1CBP antibody, Hs.6454 antibody, IIP-1 antibody, NIP antibody, RGS19IP1 antibody, SEMCAP antibody, SYNECTIIN antibody, SYNECTIN antibody, TIP-2 antibody, XGIPC antibody, kermit antibody, rgs19ip1 antibody, gipc3 antibody, iip-1 antibody, Kermit antibody, semcap antibody, glut1cbp antibody, synectiin antibody, GIPC1 antibody, Glut1CIP antibody, Rgs19ip1 antibody, Semcap1 antibody, TaxIP2 antibody, Gipc antibody, Rgs19 antibody, GIPC PDZ domain containing family member 1 antibody, GIPC PDZ domain containing family member 1 L homeolog antibody, GIPC PDZ domain containing family, member 1 antibody, RGS-GAIP interacting protein GIPC antibody, PDZ domain-containing protein GIPC3 antibody, putative rgs-gaip interacting protein gipc antibody, GIPC1 antibody, gipc1.L antibody, gipc1 antibody, Gipc1 antibody, LOC692815 antibody, LOC5576629 antibody, Smp_170870 antibody
- Background
- GIPC1 belongs to the GIPC family. It may be involved in G protein-linked signaling.
- Molecular Weight
- 37 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-