RBM7 antibody (Middle Region)
-
- Target See all RBM7 Antibodies
- RBM7 (RNA Binding Motif Protein 7 (RBM7))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RBM7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RBM7 antibody was raised against the middle region of RBM7
- Purification
- Affinity purified
- Immunogen
- RBM7 antibody was raised using the middle region of RBM7 corresponding to a region with amino acids SFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYR
- Top Product
- Discover our top product RBM7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RBM7 Blocking Peptide, catalog no. 33R-8434, is also available for use as a blocking control in assays to test for specificity of this RBM7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBM7 (RNA Binding Motif Protein 7 (RBM7))
- Alternative Name
- RBM7 (RBM7 Products)
- Synonyms
- 1200007M24Rik antibody, 1500011D06Rik antibody, AU041934 antibody, AW554393 antibody, RNA binding motif protein 7 antibody, RBM7 antibody, Rbm7 antibody
- Background
- RBM7 contains 1 RRM (RNA recognition motif) domain. It is possible involved in germ cell RNA processing and meiosis.
- Molecular Weight
- 30 kDa (MW of target protein)
-