CELF1 antibody (N-Term)
-
- Target See all CELF1 Antibodies
- CELF1 (CUGBP, Elav-Like Family Member 1 (CELF1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CELF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CUGBP1 antibody was raised against the N terminal of CUGBP1
- Purification
- Affinity purified
- Immunogen
- CUGBP1 antibody was raised using the N terminal of CUGBP1 corresponding to a region with amino acids AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT
- Top Product
- Discover our top product CELF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CUGBP1 Blocking Peptide, catalog no. 33R-1032, is also available for use as a blocking control in assays to test for specificity of this CUGBP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CELF1 (CUGBP, Elav-Like Family Member 1 (CELF1))
- Alternative Name
- CUGBP1 (CELF1 Products)
- Synonyms
- CUGBP1 antibody, BRUNOL2 antibody, CUG-BP antibody, CUGBP antibody, EDEN-BP antibody, NAB50 antibody, NAPOR antibody, hNab50 antibody, 1600010O03Rik antibody, AA407467 antibody, Brunol2 antibody, CUG-BP1 antibody, Cugbp1 antibody, D2Wsu101e antibody, HNAB50 antibody, Bruno-like antibody, brul antibody, cb920 antibody, cugbp1 antibody, brunol2 antibody, cug-bp antibody, cug-bp1 antibody, cugbp antibody, cugbp1-a antibody, eden-bp antibody, edenbp antibody, nab50 antibody, CUGBP Elav-like family member 1 antibody, CUGBP, Elav-like family member 1 antibody, cugbp, Elav-like family member 1 antibody, CUGBP Elav-like family member 1 L homeolog antibody, CELF1 antibody, Celf1 antibody, celf1 antibody, celf1.L antibody
- Background
- Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Molecular Weight
- 52 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-