CELF1 antibody (N-Term)

Catalog No. ABIN633435

This anti-CELF1 antibody is a Rabbit Polyclonal antibody detecting CELF1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for CELF1 antibody (N-Term) (ABIN633435)

Target: CELF1 (CUGBP, Elav-Like Family Member 1 (CELF1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CELF1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CELF1 Antibody

Binding Specificity: N-Term

Specificity: CUGBP1 antibody was raised against the N terminal of CUGBP1

Purification: Affinity purified

Immunogen: CUGBP1 antibody was raised using the N terminal of CUGBP1 corresponding to a region with amino acids AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CUGBP1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CUGBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CELF1

Target: CELF1 (CUGBP, Elav-Like Family Member 1 (CELF1))

Alternative Name: CUGBP1

Background: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization