CPSF1 antibody (Middle Region)

Catalog No. ABIN633437

Product Details anti-CPSF1 Antibody

Target: CPSF1 (Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPSF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CPSF1 antibody was raised against the middle region of CPSF1

Purification: Affinity purified

Immunogen: CPSF1 antibody was raised using the middle region of CPSF1 corresponding to a region with amino acids GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSRE

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CPSF1 Blocking Peptide, catalog no. 33R-3195, is also available for use as a blocking control in assays to test for specificity of this CPSF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPSF1

Target: CPSF1 (Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1))

Alternative Name: CPSF1 (CPSF1 Products)

Background: CPSF1 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction.

Molecular Weight: 161 kDa (MW of target protein)