EIF4G1 antibody (Middle Region)
-
- Target See all EIF4G1 Antibodies
- EIF4G1 (Eukaryotic Translation Initiation Factor 4 Gamma, 1 (EIF4G1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EIF4G1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EIF4 G1 antibody was raised against the middle region of EIF4 1
- Purification
- Affinity purified
- Immunogen
- EIF4 G1 antibody was raised using the middle region of EIF4 1 corresponding to a region with amino acids PAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQ
- Top Product
- Discover our top product EIF4G1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EIF4G1 Blocking Peptide, catalog no. 33R-6989, is also available for use as a blocking control in assays to test for specificity of this EIF4G1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF4G1 (Eukaryotic Translation Initiation Factor 4 Gamma, 1 (EIF4G1))
- Alternative Name
- EIF4G1 (EIF4G1 Products)
- Background
- EIF4G1 is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome.
- Molecular Weight
- 175 kDa (MW of target protein)
-