EIF4G1 antibody (Middle Region)

Catalog No. ABIN633448

Product Details anti-EIF4G1 Antibody

Target: EIF4G1 (Eukaryotic Translation Initiation Factor 4 Gamma, 1 (EIF4G1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF4G1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EIF4 G1 antibody was raised against the middle region of EIF4 1

Purification: Affinity purified

Immunogen: EIF4 G1 antibody was raised using the middle region of EIF4 1 corresponding to a region with amino acids PAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF4G1 Blocking Peptide, catalog no. 33R-6989, is also available for use as a blocking control in assays to test for specificity of this EIF4G1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF4G1

Target: EIF4G1 (Eukaryotic Translation Initiation Factor 4 Gamma, 1 (EIF4G1))

Alternative Name: EIF4G1 (EIF4G1 Products)

Background: EIF4G1 is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome.

Molecular Weight: 175 kDa (MW of target protein)