Synaptojanin 1 antibody (N-Term)

Catalog No. ABIN633450

This anti-Synaptojanin 1 antibody is a Rabbit Polyclonal antibody detecting Synaptojanin 1 in WB. Suitable for Human.

Quick Overview for Synaptojanin 1 antibody (N-Term) (ABIN633450)

Target: Synaptojanin 1 (SYNJ1)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Synaptojanin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Synaptojanin 1 Antibody

Binding Specificity: N-Term

Specificity: Synaptojanin 1 antibody was raised against the N terminal of SYNJ1

Purification: Affinity purified

Immunogen: Synaptojanin 1 antibody was raised using the N terminal of SYNJ1 corresponding to a region with amino acids IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Synaptojanin 1 Blocking Peptide, (ABIN939316), is also available for use as a blocking control in assays to test for specificity of this Synaptojanin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNJ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Synaptojanin 1

Target: Synaptojanin 1 (SYNJ1)

Alternative Name: Synaptojanin 1

Background: Synaptojanin 1 is a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking.

Molecular Weight: 143 kDa (MW of target protein)

Pathways: Inositol Metabolic Process, Synaptic Vesicle Exocytosis