SFRS8 antibody

Catalog No. ABIN633458

The Rabbit Polyclonal anti-SFRS8 antibody has been validated for WB. It is suitable to detect SFRS8 in samples from Human and Mouse.

Quick Overview for SFRS8 antibody (ABIN633458)

Target: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFRS8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SFRS8 Antibody

Purification: Affinity purified

Immunogen: SFRS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLSE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFRS8 Blocking Peptide, (ABIN5616105), is also available for use as a blocking control in assays to test for specificity of this SFRS8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFRS8

Target: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Alternative Name: SFRS8

Background: This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Multiple alternatively spliced variants have been identified although their full-length natures have not been characterized to date.

Molecular Weight: 105 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization