FAM156A antibody (N-Term)

Catalog No. ABIN633460

This Rabbit Polyclonal antibody specifically detects FAM156A in WB. It exhibits reactivity toward Human.

Quick Overview for FAM156A antibody (N-Term) (ABIN633460)

Target: FAM156A (Family with Sequence Similarity 156, Member A (FAM156A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM156A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM156A Antibody

Binding Specificity: N-Term

Specificity: FAM156 A antibody was raised against the N terminal of FAM156

Purification: Affinity purified

Immunogen: FAM156 A antibody was raised using the N terminal of FAM156 corresponding to a region with amino acids DPLQKRNPASPSKSSPMTAAETSQEGPAPSQPSYSEQPMMGLSNLSPGPG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM156A Blocking Peptide, (ABIN937492), is also available for use as a blocking control in assays to test for specificity of this FAM156A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM150 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM156A

Target: FAM156A (Family with Sequence Similarity 156, Member A (FAM156A))

Alternative Name: FAM156A

Background: The function of FAM156A protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 24 kDa (MW of target protein)