EIF2S1 antibody (N-Term)

Catalog No. ABIN633461

The Rabbit Polyclonal anti-EIF2S1 antibody has been validated for WB. It is suitable to detect EIF2S1 in samples from Human, Mouse, Rat and Drosophila melanogaster.

Quick Overview for EIF2S1 antibody (N-Term) (ABIN633461)

Target: EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))

Reactivity: Human, Mouse, Rat, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF2S1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EIF2S1 Antibody

Binding Specificity: N-Term

Specificity: EIF2 S1 antibody was raised against the N terminal of EIF2 1

Purification: Affinity purified

Immunogen: EIF2 S1 antibody was raised using the N terminal of EIF2 1 corresponding to a region with amino acids VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF2S1 Blocking Peptide, (ABIN5613327), is also available for use as a blocking control in assays to test for specificity of this EIF2S1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF2S1

Target: EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))

Alternative Name: EIF2S1

Background: The translation initiation factor eIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, eIF2, and GTP.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, ER-Nucleus Signaling, Hepatitis C