EXOSC6 antibody (N-Term)

Catalog No. ABIN633462

This anti-EXOSC6 antibody is a Rabbit Polyclonal antibody detecting EXOSC6 in WB. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for EXOSC6 antibody (N-Term) (ABIN633462)

Target: EXOSC6 (Exosome Component 6 (EXOSC6))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOSC6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EXOSC6 Antibody

Binding Specificity: N-Term

Specificity: EXOSC6 antibody was raised against the N terminal of EXOSC6

Purification: Affinity purified

Immunogen: EXOSC6 antibody was raised using the N terminal of EXOSC6 corresponding to a region with amino acids LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOSC6 Blocking Peptide, (ABIN5613436), is also available for use as a blocking control in assays to test for specificity of this EXOSC6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOSC6

Target: EXOSC6 (Exosome Component 6 (EXOSC6))

Alternative Name: EXOSC6

Background: EXOSC6 constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response