FOXRED1 antibody (N-Term)

Catalog No. ABIN633466

This Rabbit Polyclonal antibody specifically detects FOXRED1 in WB. It exhibits reactivity toward Human.

Quick Overview for FOXRED1 antibody (N-Term) (ABIN633466)

Target: FOXRED1 (FAD-Dependent Oxidoreductase Domain Containing 1 (FOXRED1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FOXRED1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FOXRED1 Antibody

Binding Specificity: N-Term

Specificity: FOXRED1 antibody was raised against the N terminal of FOXRED1

Purification: Affinity purified

Immunogen: FOXRED1 antibody was raised using the N terminal of FOXRED1 corresponding to a region with amino acids SEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLGLSVAYWLKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FOXRED1 Blocking Peptide, (ABIN5613640), is also available for use as a blocking control in assays to test for specificity of this FOXRED1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FOXRED1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FOXRED1

Target: FOXRED1 (FAD-Dependent Oxidoreductase Domain Containing 1 (FOXRED1))

Alternative Name: FOXRED1

Background: The FOXRED1 protein contains a FAD-dependent oxidoreductase domain. The encoded protein is localized to the mitochondria and may function as a chaperone protein required for the function of mitochondrial complex I. Mutations in this gene are associated with mitochondrial complex I deficiency. Alternatively spliced transcript variants have been observed for this gene.

Molecular Weight: 54 kDa (MW of target protein)