EIF4G2 antibody (C-Term)
-
- Target See all EIF4G2 Antibodies
- EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EIF4G2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- EIF4 G2 antibody was raised against the C terminal of EIF4 2
- Purification
- Affinity purified
- Immunogen
- EIF4 G2 antibody was raised using the C terminal of EIF4 2 corresponding to a region with amino acids KGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPV
- Top Product
- Discover our top product EIF4G2 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EIF4G2 Blocking Peptide, catalog no. 33R-4390, is also available for use as a blocking control in assays to test for specificity of this EIF4G2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2))
- Alternative Name
- EIF4G2 (EIF4G2 Products)
- Background
- Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes.
- Molecular Weight
- 39 kDa (MW of target protein)
-