EIF4A2 antibody (N-Term)

Catalog No. ABIN633476

The Rabbit Polyclonal anti-EIF4A2 antibody has been validated for WB. It is suitable to detect EIF4A2 in samples from Human, Rat, Mouse and Dog.

Quick Overview for EIF4A2 antibody (N-Term) (ABIN633476)

Target: EIF4A2 (Eukaryotic Translation Initiation Factor 4A2 (EIF4A2))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF4A2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EIF4A2 Antibody

Binding Specificity: N-Term

Specificity: EIF4 A2 antibody was raised against the N terminal of EIF4 2

Purification: Affinity purified

Immunogen: EIF4 A2 antibody was raised using the N terminal of EIF4 2 corresponding to a region with amino acids MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYA

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF4A2 Blocking Peptide, (ABIN5613337), is also available for use as a blocking control in assays to test for specificity of this EIF4A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF4A2

Target: EIF4A2 (Eukaryotic Translation Initiation Factor 4A2 (EIF4A2))

Alternative Name: EIF4A2

Background: EIF4A2 contains 1 helicase C-terminal domain and 1 helicase ATP-binding domain. It belongs to the DEAD box helicase family. eIF4A subfamily. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5' untranslated region of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.

Molecular Weight: 45 kDa (MW of target protein)