RPLP0 antibody (N-Term)

Catalog No. ABIN633509

The Rabbit Polyclonal anti-RPLP0 antibody has been validated for WB. It is suitable to detect RPLP0 in samples from Human, Mouse and Rat.

Quick Overview for RPLP0 antibody (N-Term) (ABIN633509)

Target: RPLP0 (Ribosomal Protein, Large, P0 (RPLP0))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPLP0 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPLP0 Antibody

Binding Specificity: N-Term

Specificity: RPLP0 antibody was raised against the N terminal of RPLP0

Purification: Affinity purified

Immunogen: RPLP0 antibody was raised using the N terminal of RPLP0 corresponding to a region with amino acids TEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITT

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPLP0 Blocking Peptide, (ABIN5615943), is also available for use as a blocking control in assays to test for specificity of this RPLP0 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPLP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPLP0

Target: RPLP0 (Ribosomal Protein, Large, P0 (RPLP0))

Alternative Name: RPLP0

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. The ribosomal protein is a component of the 60S subunit. The protein, which is the functional equivalent of the E. coli L10 ribosomal protein, belongs to the L10P family of ribosomal proteins.

Molecular Weight: 34 kDa (MW of target protein)