PABPC1L2A antibody

Catalog No. ABIN633510

This anti-PABPC1L2A antibody is a Rabbit Polyclonal antibody detecting PABPC1L2A in WB. Suitable for Human.

Quick Overview for PABPC1L2A antibody (ABIN633510)

Target: PABPC1L2A (Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PABPC1L2A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PABPC1L2A Antibody

Purification: Affinity purified

Immunogen: PABPC1 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PABPC1L2A Blocking Peptide, (ABIN5615184), is also available for use as a blocking control in assays to test for specificity of this PABPC1L2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PABPC1L2A

Target: PABPC1L2A (Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A))

Alternative Name: PABPC1L2A

Background: PABPC1L2A may be involved in nucleic acid and nucleotide binding

Molecular Weight: 23 kDa (MW of target protein)