CTA-126B4.3 (N-Term) antibody

Catalog No. ABIN633524

The Rabbit Polyclonal anti-CTA-126B4.3 antibody is suitable to detect CTA-126B4.3 in samples from Human. It has been validated for WB.

Quick Overview for CTA-126B4.3 (N-Term) antibody (ABIN633524)

Target: CTA-126B4.3

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: N-Term

Specificity: CTA-126 B4.3 antibody was raised against the N terminal of CTA-126 4.3

Purification: Affinity purified

Immunogen: CTA-126 B4.3 antibody was raised using the N terminal of CTA-126 4.3 corresponding to a region with amino acids NVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVP

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CTA-126B4.3 Blocking Peptide, (ABIN5613023), is also available for use as a blocking control in assays to test for specificity of this CTA-126B4.3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTA-120 4.3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: CTA-126B4.3

Background: The function of CTA-126B4.3 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 32 kDa (MW of target protein)