ADARB2 antibody
-
- Target See all ADARB2 Antibodies
- ADARB2 (Adenosine Deaminase, RNA-Specific, B2 (ADARB2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADARB2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG
- Top Product
- Discover our top product ADARB2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADARB2 Blocking Peptide, ABIN5611942, is also available for use as a blocking control in assays to test for specificity of this ADARB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADARB2 (Adenosine Deaminase, RNA-Specific, B2 (ADARB2))
- Alternative Name
- ADARB2 (ADARB2 Products)
- Background
- ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing.
- Molecular Weight
- 80 kDa (MW of target protein)
-