ADARB2 antibody

Catalog No. ABIN633530

Product Details anti-ADARB2 Antibody

Target: ADARB2 (Adenosine Deaminase, RNA-Specific, B2 (ADARB2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADARB2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ADARB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADARB2 Blocking Peptide, ABIN5611942, is also available for use as a blocking control in assays to test for specificity of this ADARB2 antibody

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADARB2

Target: ADARB2 (Adenosine Deaminase, RNA-Specific, B2 (ADARB2))

Alternative Name: ADARB2 (ADARB2 Products)

Synonyms: Adar3 antibody, RED2 antibody, Red2 antibody, ADAR3 antibody, si:dkey-255g15.1 antibody, double-stranded RNA-specific editase B2 antibody, adenosine deaminase, RNA specific B2 (inactive) antibody, adenosine deaminase, RNA-specific, B2 antibody, adenosine deaminase, RNA-specific, B2 (non-functional) antibody, LOC722075 antibody, LOC742985 antibody, ADARB2 antibody, Adarb2 antibody, adarb2 antibody

Background: ADARB2 is a member of the double-stranded RNA adenosine deaminase family of RNA-editing enzymes and may play a regulatory role in RNA editing.

Molecular Weight: 80 kDa (MW of target protein)