PAPOLB antibody (N-Term)

Catalog No. ABIN633532

This Rabbit Polyclonal antibody specifically detects PAPOLB in WB. It exhibits reactivity toward Human.

Quick Overview for PAPOLB antibody (N-Term) (ABIN633532)

Target: PAPOLB (Poly(A) Polymerase beta (Testis Specific) (PAPOLB))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAPOLB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PAPOLB Antibody

Binding Specificity: N-Term

Specificity: PAPOLB antibody was raised against the N terminal of PAPOLB

Purification: Affinity purified

Immunogen: PAPOLB antibody was raised using the N terminal of PAPOLB corresponding to a region with amino acids TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAPOLB Blocking Peptide, (ABIN5615210), is also available for use as a blocking control in assays to test for specificity of this PAPOLB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAPOLB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAPOLB

Target: PAPOLB (Poly(A) Polymerase beta (Testis Specific) (PAPOLB))

Alternative Name: PAPOLB

Background: PAPOLB may be involved in transferase activity, polynucleotide adenylyltransferase activity, protein binding, RNA binding, nucleotide binding, ATP binding and nucleotidyltransferase activity.

Molecular Weight: 72 kDa (MW of target protein)