ESRP2 antibody (N-Term)

Catalog No. ABIN633540

This anti-ESRP2 antibody is a Rabbit Polyclonal antibody detecting ESRP2 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for ESRP2 antibody (N-Term) (ABIN633540)

Target: ESRP2 (Epithelial Splicing Regulatory Protein 2 (ESRP2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ESRP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ESRP2 Antibody

Binding Specificity: N-Term

Specificity: RBM35 B antibody was raised against the N terminal of RBM35

Purification: Affinity purified

Immunogen: RBM35 B antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM35B Blocking Peptide, (ABIN936934), is also available for use as a blocking control in assays to test for specificity of this RBM35B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ESRP2

Target: ESRP2 (Epithelial Splicing Regulatory Protein 2 (ESRP2))

Alternative Name: RBM35B

Background: RBM35B contains 3 RRM (RNA recognition motif) domains. ESRP1 and ESRP2 (RBM35B) are epithelial cell-type-specific regulators of FGFR2 splicing.

Molecular Weight: 77 kDa (MW of target protein)