RPF1 antibody (N-Term)

Catalog No. ABIN633541

This Rabbit Polyclonal antibody specifically detects RPF1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for RPF1 antibody (N-Term) (ABIN633541)

Target: RPF1 (Brix Domain Containing 5 (RPF1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPF1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPF1 Antibody

Binding Specificity: N-Term

Specificity: BXDC5 antibody was raised against the N terminal of BXDC5

Purification: Affinity purified

Immunogen: BXDC5 antibody was raised using the N terminal of BXDC5 corresponding to a region with amino acids AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BXDC5 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this BXDC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BXDC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPF1

Target: RPF1 (Brix Domain Containing 5 (RPF1))

Alternative Name: BXDC5

Background: BXDC5 may be required for ribosome biogenesis.

Molecular Weight: 38 kDa (MW of target protein)