RALYL antibody (C-Term)

Catalog No. ABIN633555

This anti-RALYL antibody is a Rabbit Polyclonal antibody detecting RALYL in WB. Suitable for Human.

Quick Overview for RALYL antibody (C-Term) (ABIN633555)

Target: RALYL (RALY RNA Binding Protein-Like (RALYL))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RALYL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RALYL Antibody

Binding Specificity: C-Term

Specificity: RALYL antibody was raised against the C terminal of RALYL

Purification: Affinity purified

Immunogen: RALYL antibody was raised using the C terminal of RALYL corresponding to a region with amino acids AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RALYL Blocking Peptide, (ABIN936836), is also available for use as a blocking control in assays to test for specificity of this RALYL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALYL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RALYL

Target: RALYL (RALY RNA Binding Protein-Like (RALYL))

Alternative Name: RALYL

Background: RALYL belongs to the RRM HNRPC family, RALY subfamily. It contains 1 RRM (RNA recognition motif) domain. The functions of RALYL remain unknown.

Molecular Weight: 32 kDa (MW of target protein)