EIF3G antibody (Middle Region)

Catalog No. ABIN633566

The Rabbit Polyclonal anti-EIF3G antibody has been validated for WB. It is suitable to detect EIF3G in samples from Human, Mouse and Rat.

Quick Overview for EIF3G antibody (Middle Region) (ABIN633566)

Target: EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF3G antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-EIF3G Antibody

Binding Specificity: Middle Region

Specificity: EIF3 G antibody was raised against the middle region of EIF3

Purification: Affinity purified

Immunogen: EIF3 G antibody was raised using the middle region of EIF3 corresponding to a region with amino acids LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF3G Blocking Peptide, (ABIN5613331), is also available for use as a blocking control in assays to test for specificity of this EIF3G antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF3G

Target: EIF3G (Eukaryotic Translation Initiation Factor 3, Subunit G (EIF3G))

Alternative Name: EIF3G

Background: EIF3G belongs to the eIF-3 subunit G family. It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization