Aconitase 1 antibody (N-Term)

Catalog No. ABIN633567

This anti-Aconitase 1 antibody is a Rabbit Polyclonal antibody detecting Aconitase 1 in WB and IHC. Suitable for Human and Rat.

Quick Overview for Aconitase 1 antibody (N-Term) (ABIN633567)

Target: Aconitase 1 (ACO1)

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Aconitase 1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-Aconitase 1 Antibody

Binding Specificity: N-Term

Specificity: ACO1 antibody was raised against the N terminal of ACO1

Purification: Affinity purified

Immunogen: ACO1 antibody was raised using the N terminal of ACO1 corresponding to a region with amino acids MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 12 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACO1 Blocking Peptide, (ABIN5611903), is also available for use as a blocking control in assays to test for specificity of this ACO1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Aconitase 1

Target: Aconitase 1 (ACO1)

Alternative Name: ACO1

Background: ACO1, also known as iron regulatory element binding protein 1 (IREB1), is a cytosolic protein which binds to iron-responsive elements (IREs). It plays a central role in cellular iron homeostasis. It was also shown to have aconitase activity, and hence grouped with the aconitase family of enzymes.

Molecular Weight: 98 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis