CSTF2T antibody (C-Term)

Catalog No. ABIN633569

The Rabbit Polyclonal anti-CSTF2T antibody is suitable to detect CSTF2T in samples from Human. It has been validated for WB.

Quick Overview for CSTF2T antibody (C-Term) (ABIN633569)

Target: CSTF2T (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa, tau Variant (CSTF2T))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CSTF2T antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CSTF2T Antibody

Binding Specificity: C-Term

Specificity: CSTF2 T antibody was raised against the C terminal of CSTF2

Purification: Affinity purified

Immunogen: CSTF2 T antibody was raised using the C terminal of CSTF2 corresponding to a region with amino acids AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CSTF2T Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CSTF2T antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CSTF2T

Target: CSTF2T (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa, tau Variant (CSTF2T))

Alternative Name: CSTF2T

Background: CSTF2T may play a significant role in AAUAAA-independent mRNA polyadenylation in germ cells. It is directly involved in the binding to pre-mRNAs.

Molecular Weight: 64 kDa (MW of target protein)