CSTF2T antibody (C-Term)
-
- Target See all CSTF2T Antibodies
- CSTF2T (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa, tau Variant (CSTF2T))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CSTF2T antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CSTF2 T antibody was raised against the C terminal of CSTF2
- Purification
- Affinity purified
- Immunogen
- CSTF2 T antibody was raised using the C terminal of CSTF2 corresponding to a region with amino acids AGIQGGGMQGAGIQGVSIQGGGIQGGGIQGASKQGGSQPSSFSPGQSQVT
- Top Product
- Discover our top product CSTF2T Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CSTF2T Blocking Peptide, catalog no. 33R-1203, is also available for use as a blocking control in assays to test for specificity of this CSTF2T antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSTF2T (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa, tau Variant (CSTF2T))
- Alternative Name
- CSTF2T (CSTF2T Products)
- Synonyms
- 64kDa antibody, C77975 antibody, tCstF-64 antibody, tauCstF-64 antibody, CstF-64T antibody, cleavage stimulation factor, 3' pre-RNA subunit 2, tau antibody, cleavage stimulation factor subunit 2 tau variant antibody, cleavage stimulation factor subunit 2, tau variant antibody, Cstf2t antibody, CSTF2T antibody
- Background
- CSTF2T may play a significant role in AAUAAA-independent mRNA polyadenylation in germ cells. It is directly involved in the binding to pre-mRNAs.
- Molecular Weight
- 64 kDa (MW of target protein)
-