BCAS2 antibody (N-Term)

Catalog No. ABIN633573

This anti-BCAS2 antibody is a Rabbit Polyclonal antibody detecting BCAS2 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for BCAS2 antibody (N-Term) (ABIN633573)

Target: BCAS2 (Breast Carcinoma Amplified Sequence 2 (BCAS2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BCAS2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BCAS2 Antibody

Binding Specificity: N-Term

Specificity: BCAS2 antibody was raised against the N terminal of BCAS2

Purification: Affinity purified

Immunogen: BCAS2 antibody was raised using the N terminal of BCAS2 corresponding to a region with amino acids MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BCAS2 Blocking Peptide, (ABIN5612290), is also available for use as a blocking control in assays to test for specificity of this BCAS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BCAS2

Target: BCAS2 (Breast Carcinoma Amplified Sequence 2 (BCAS2))

Alternative Name: BCAS2

Background: BCAS2 belongs to the SPF27 family. It is involved in mRNA splicing. The protein might play an important role in breast cancer development by increasing the estrogen receptor's function.

Molecular Weight: 26 kDa (MW of target protein)