DDX28 antibody

Catalog No. ABIN633598

Product Details anti-DDX28 Antibody

Target: DDX28 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 28 (DDX28))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDX28 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DDX28 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDX28 Blocking Peptide, catalog no. 33R-3063, is also available for use as a blocking control in assays to test for specificity of this DDX28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDX28

Target: DDX28 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 28 (DDX28))

Alternative Name: DDX28 (DDX28 Products)

Synonyms: MDDX28 antibody, 2410004K13Rik antibody, AI449652 antibody, Mddx28 antibody, DEAD-box helicase 28 antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 28 antibody, DDX28 antibody, Ddx28 antibody

Background: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX28 is an RNA-dependent ATPase. DDX28 is localized in the mitochondria and the nucleus, and can be transported between the mitochondria and the nucleus.

Molecular Weight: 59 kDa (MW of target protein)