KCTD15 antibody (N-Term)

Catalog No. ABIN633619

This Rabbit Polyclonal antibody specifically detects KCTD15 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for KCTD15 antibody (N-Term) (ABIN633619)

Target: KCTD15 (Potassium Channel Tetramerisation Domain Containing 15 (KCTD15))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KCTD15 Antibody

Binding Specificity: N-Term

Specificity: KCTD15 antibody was raised against the N terminal of KCTD15

Purification: Affinity purified

Immunogen: KCTD15 antibody was raised using the N terminal of KCTD15 corresponding to a region with amino acids PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD15 Blocking Peptide, (ABIN5614304), is also available for use as a blocking control in assays to test for specificity of this KCTD15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD15

Target: KCTD15 (Potassium Channel Tetramerisation Domain Containing 15 (KCTD15))

Alternative Name: KCTD15

Background: KCTD15 contains 1 BTB (POZ) domain. The exact function of KCTD15 is not known.

Molecular Weight: 26 kDa (MW of target protein)