KCTD19 antibody (N-Term)

Catalog No. ABIN633630

The Rabbit Polyclonal anti-KCTD19 antibody (ABIN633630) specifically detects KCTD19 in WB. The antibody is reactive with Human samples.

Quick Overview for KCTD19 antibody (N-Term) (ABIN633630)

Target: KCTD19 (Potassium Channel Tetramerisation Domain Containing 19 (KCTD19))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD19 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KCTD19 Antibody

Binding Specificity: N-Term

Specificity: KCTD19 antibody was raised against the n terminal of KCTD19

Purification: Affinity purified

Immunogen: KCTD19 antibody was raised using the N terminal of KCTD19 corresponding to a region with amino acids DSLLWKEASALTSSESQRLFIDRDGSTFRHVHYYLYTSKLSFSSCAELNL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD19 Blocking Peptide, (ABIN937554), is also available for use as a blocking control in assays to test for specificity of this KCTD19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD19

Target: KCTD19 (Potassium Channel Tetramerisation Domain Containing 19 (KCTD19))

Alternative Name: KCTD19

Background: The function of KCTD19 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 102 kDa (MW of target protein)